• My NEB
  • Print
  • PDF
  • FAQ: What is the amino acid sequence Trypsin-ultra?

    The amino acid sequence of bovine trypsin is: 

    IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG
    NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG
    WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGP
    VVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 

    We do modify it by acetylating some but not all Lysine residues, so if you are searching for Trypsin peptides allow for acetyl-groups as a modification.