• My NEB
  • Print
  • PDF
  • FAQ: What is the sequence for this Trypsin?

    The sequence for Bovine Trypsin sequence is: 

    IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG
    NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG
    WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGP
    VVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 

    We do modify it by acetylating some but not all Lysine residues, so if you are searching for Trypsin peptides allow for acetyl-groups as a modification.