FAQ: What is the amino acid sequence Trypsin-ultra?

The amino acid sequence of bovine trypsin is: 

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG
NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG
WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGP
VVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN 

We do modify it by acetylating some but not all Lysine residues, so if you are searching for Trypsin peptides allow for acetyl-groups as a modification.