FAQ: What is the Endoproteinase AspN sequence in text format?

Here is the sequence of Endoproteinase AspN: TIVSSFIKTWPNATVYYTLPSQGSLSTQAYNTFLTNINKAFDMISSKTSV KFVQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYNTTYPAIIAHEIM HSMGIMHEQCRPDRDQYIIVDTNRAQDGTRHNFNLYNDYAGHGEFDFGSV MMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNST SATNGTYTLTTSLAGDKNIDITGSSTADGTDVILYSATTGNNQKFIFRKS EHGYFTIKSILDSTKVLTVRNNGTANGTAVELRTNADTDAQKWLLFNLGN EGFGFAPKNAPSLRLEVKDGLTTNLTPIVIGSTDQTLQPYTKQRFTLTKVN
Loading Spinner