• My NEB
  • Print
  • PDF
  • FAQ: What is the Endoproteinase AspN sequence in text format?

    Here is the sequence of Endoproteinase AspN: TIVSSFIKTWPNATVYYTLPSQGSLSTQAYNTFLTNINKAFDMISSKTSV KFVQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYNTTYPAIIAHEIM HSMGIMHEQCRPDRDQYIIVDTNRAQDGTRHNFNLYNDYAGHGEFDFGSV MMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNST SATNGTYTLTTSLAGDKNIDITGSSTADGTDVILYSATTGNNQKFIFRKS EHGYFTIKSILDSTKVLTVRNNGTANGTAVELRTNADTDAQKWLLFNLGN EGFGFAPKNAPSLRLEVKDGLTTNLTPIVIGSTDQTLQPYTKQRFTLTKVN